PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_AED68C680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 263aa    MW: 29505.7 Da    PI: 8.9146
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_AED68C680.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd++l  ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Traes_5BL_AED68C680.1 14 KGAWTKEEDDRLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                           79******************************99************97 PP

2Myb_DNA-binding57.53.2e-1867111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+++ eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Traes_5BL_AED68C680.1  67 RGNFSDEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.407961IPR017930Myb domain
SuperFamilySSF466898.07E-2913108IPR009057Homeodomain-like
SMARTSM007176.3E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-141461IPR001005SANT/Myb domain
CDDcd001678.62E-101661No hitNo description
PROSITE profilePS5129428.57562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765116IPR009057Homeodomain-like
SMARTSM007173.3E-1766114IPR001005SANT/Myb domain
PfamPF002492.5E-1667111IPR001005SANT/Myb domain
CDDcd001672.00E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLTAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF SDEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLTSRG  120
IDPVTHRAIN SDHAASNITI SFEAAQRDDK GAVFRRDAEP TKVAAAAAAI THVDHHHRSN  180
PHHQMEWGQG KALKCPDLNL DLCISPPSHE DPMVDTKPVV KREAVVGLCF SCSMGLPRSA  240
DCKCSSFMGL RTAMLDFRSI EMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519120.0JF951912.1 Triticum aestivum clone TaMYB29 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578527.11e-142PREDICTED: myb-related protein Hv1
SwissprotP200261e-174MYB1_HORVU; Myb-related protein Hv1
TrEMBLW5FGG70.0W5FGG7_WHEAT; Uncharacterized protein
STRINGBRADI4G36460.11e-141(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.17e-97myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]